SKU: 24564791044

LR3-IGF1 Protein, Human(Media Grade)

Sale price$50.40 Regular price$56.00
Save 10%

Pay in installments of $14.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 30 - Sep 4

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

LR3-IGF1 Protein, Human(Media Grade)Product Specification Species Human Synonyms Insulin Like Growth Factor I; IGF I; Mechano Growth Factor; MGF; Somatomedin C; IGF1; IBP1; LR3 IGF 1; LR3 Insulin like Growth factor 1 Amino Acid Sequence MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA Expression System E. coli Molecular Weight Approximately 9. 1 kDa, a single non glycosylated polypeptide chain containing 83 amino acids. Purity 98% by SDS PAGE or 90% by

Product Specification


Species Human
Synonyms Insulin-Like Growth Factor I; IGF-I; Mechano Growth Factor; MGF; Somatomedin-C; IGF1; IBP1; LR3-IGF-1; LR3 Insulin-like Growth factor-1
Amino Acid Sequence

MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA

Expression System E.coli
Molecular Weight Approximately 9.1 kDa, a single non-glycosylated polypeptide chain containing 83 amino acids.
Purity >98% by SDS-PAGE or >90% by HPLC.
Endotoxin <0.01EU/μg
Conjugation Unconjugated
Tag No Tag
Physical Appearance Lyophilized Powder
Storage Buffer

10 mM PB, pH 7.0

Reconstitution Before use this product, please read the direction below carefully.
This vial must be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in a sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/ml.
Stock solutions should be apportioned into working aliquots and stored at ≤ -20℃.
Further dilutions should be made in appropriate buffered solutions.
Stability & Storage

For long term storage, the product should be stored ≤ -20℃.
Please avoid repeated freeze-thaw cycles after reconstitution.
12 months from date of receipt, -20 to -70℃ as supplied.
1 month, 2 to 8℃ under sterile conditions after reconstitution.
3 months, -20 to -70℃ under sterile conditions after reconstitution.

Background

The IGFs are mitogenic, polypeptide growth factors that stimulate the proliferation and survival of various cell types, including muscle, bone, and cartilage tissue in vitro. IGFs are predominantly produced by the liver, although a variety of tissues produce the IGFs at distinctive times. The IGFs belong to the Insulin gene family, which also contains insulin and relaxin. The IGFs are similar to insulin by structure and function, but have a much higher growth-promoting activity than insulin. IGF-II expression is influenced by placenta lactogen, while IGF-I expression is regulated by growth hormone. Both IGF-I and IGF-II signal through the tyrosine kinase type I receptor (IGF-IR) , but IGF-II can also signal through the IGF-II/Mannose-6-phosphate receptor. Mature IGFs are generated by proteolytic processing of inactive precursor proteins, which contain N-terminal and C-terminal propeptide regions. Recombinant human IGF-I and IGF-II are globular proteins containing 70 and 67 amino acids., respectively, and 3 intra-molecular disulfide bonds. IGF-I LR3 is a recombinant analog of human IGF-I comprised of the complete IGF-I sequence, with an Arginine substitution for the third position Glutamic acid, and a 13 amino acid length N terminus peptide extension. Specifically engineered for higher biological potency in vitro, IGF-I LR3 has an increased half-life and a binding aversion to native proteins within the body that make it ideal for both research and large-scale culturing. Recombinant Human IGF-I LR3 is a 9.1 kDa, single, non-glycosylated polypeptide chain containing 83 amino acid.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 24564791044

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.5 ★★★★★
Based on 30 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
N
NJ
Lexington, US
★★★★★ 4
Good Variety Pack With Solid Compatibility, But No Protective Caps
This is a review for this 21-piece variety pack of Dr. Pen microneedling cartridges. For around $32, this actually feels like a pretty solid value overall. You’re getting seven nano cartridges, seven 12-pin, and seven 36-pin, so it’s a nice mix depending on whether you’re doing product infusion, lighter treatments, or more intensive microneedling sessions. I always appreciate a variety pack because otherwise you end up buying giant boxes of one type and suddenly becoming emotionally committed to 36-pin needles for the next six years. These fit my Dr. Pen M7/M7S perfectly with no issues clicking into place or staying secure during use. I didn’t have any wobbling, uneven dragging, or weird skipping while microneedling. Functionally, they performed just as well as other replacement cartridges I’ve used. That said, they do look and feel a little cheaper than some other cartridges I’ve purchased before. Not necessarily unusable, just not quite as sturdy or polished-looking. Since these are single-use anyway, that may not matter to everyone, but it was noticeable. My biggest hesitation is that these do not come with protective caps over the needles. To be fair, the listing photos actually do show them packaged this way, so it’s not misleading — they were honest about it — but personally I’m just more comfortable when cartridges have caps for an added sense of sterility and protection. They are individually vacuum sealed with expiration dates, which I do appreciate, but I’ll probably use my capped cartridges first before reaching for these. Because of that, I’d feel a little more comfortable initially using these on areas like the chest or neck rather than jumping straight into facial treatments, at least until I’ve tested them more thoroughly. I’d also definitely be extra cautious about sanitizing everything beforehand. Overall though, for the quantity and variety included, this still feels like a decent buy if you go through cartridges regularly.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 8, 2026
R
Riabiaaa
Massapequa, US
★★★★★ 5
Awesome versatility, affordable, easy to use micro needles for compatible Dr. Pen devices 🫶🏽💉🤩⭐️
This microneedling cartridge refill set is a pretty great value with a convenient mix of multiple needle options. It’s super versatile and should easily meet all your microneedling skincare needs. The cartridges fit securely with compatible Dr. Pen models (mine is 7). MAKE SURE YOURS FITS!! Some devices THREAD, others DO NOT!! This is super important b/c if you don’t have the correct type, there’s nothing you can do to make them work! These refills allow for easy and effective operation without causing skin snagging, tears, or injury (other than ‘micro injury,’ which is what’s intended by the whole concept of Microneedling!). The individually sealed cartridges are sanitary, convenient for travel, and are an excellent choice for any microneedling skincare regimen. While the plastic housing/casing feels somewhat lightweight, the kit’s performance is actually top notch. I do wish they had protective caps for even more superior protection, but it’s a great deal and I can’t complain for the price. It’s a total no-brainer if you have a compatible Dr. Pen Microneedling device.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 3, 2026
M
MJ
Fort Morgan, US
★★★★★ 3
Fit My Dr Pen M7 Correctly, But Check Packaging Carefully Before Use
I purchased these replacement cartridges for my Dr Pen M7, and the fit was fine with no compatibility issues. They attached properly and worked as expected during use, so at least from a fit/function standpoint, they seem pretty standard. I also appreciate that the pack includes a variety of cartridge types and needle/pin counts instead of only one style. Having different options is useful depending on the area being treated and personal preference. One thing I did notice though is that the cartridges arrived in Dr Pen branded packaging, and I honestly wasn’t completely sure about the legitimacy/authenticity of them. They may very well be genuine, but it did make me pause a little since there wasn’t much additional verification information included. My biggest concern was that although the packages are labeled sterile, I noticed some type of brown residue/spotting inside one of the sealed cartridge packages. It appeared in multiple spots inside that particular package, so I immediately decided to throw that cartridge away rather than risk using it. Because of that, I would strongly recommend inspecting each cartridge carefully before use and sterilizing again yourself for extra precaution. With microneedling products especially, cleanliness and safety matter a lot. Overall, the cartridges themselves fit and functioned properly with my device, and I like the variety included, but quality control/sterility is something I’d advise paying close attention to before using them.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 19, 2026
B
Bruja Vieux Carré
Battle Creek, US
★★★★★ 5
Great replacement micro needling cartridges.
Picked today up for replacements for my Dr Pen micro needler. They arrived individually sealed, ready for use. They appear to be compatible good quality product just like my originals. Love the price point and savings. They fit my device perfectly. These arrived at the Dr Pen cartridge box although do not have Dr Pen brand on cartridges appear high-quality similar in packaging of the originals. They do not have the pen, cap safety guard, but that's really not a needed part of the product. Make sure to verify you have the right device. Be aware they do not fit correctly in M8 devices. Great value for the money you get 21 piece micro, needling cartridges, various needle styles. The kit comes with 36 needle, 12 needle and nano cartridges. I have already used the Nano cartridge and they are super comparable to original cartridges quality, They do not drag on the skin easily move and dispense face serum product. So far, I've been super happy with the replacements.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 29, 2026
A
AddictedToAddToCart
Boise, US
★★★★★ 5
21 Piece Pen Cartridges
This 21 piece microneedling cartridge set is an excellent value and gives a lot of versatility for different skincare needs. I really like that it includes three different tip styles: nano, 12 pin, and 36 pin. There are 7 of each variety included, which makes it easy to customize treatments depending on what area I’m focusing on and how gentle or intensive I want the session to be. The cartridges fit my Dr Pen device well and feel securely attached during use. Everything came individually packaged and clean, which is important for at home microneedling routines. The nano tips are great for product infusion and glow-focused treatments, while the 12 and 36 pin options work well for more targeted skin texture care. Overall, this is a convenient and affordable replacement set that’s perfect for anyone wanting multiple cartridge options in one package.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 22, 2026

recommand products